Structure of PDB 5x11 Chain H Binding Site BS01

Receptor Information
>5x11 Chain H (length=173) Species: 655816 (Bacillus spizizenii str. W23) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVLKYAILGLLRKGELSGYDITSYFKEELGQFWSAKHSQIYPELKKLTDE
GFITFRTTIQGTKLEKKMYTLTDSGKQELHDWLIRHQPIPETVKDEFMLK
AYFISSLSRQEASDLFTDQLLKRKAKLSDLQGSYEKLMSFSSPDFGHYLV
LTKALEREKNYVSWLESILAMID
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5x11 Structural basis of effector and operator recognition by the phenolic acid-responsive transcriptional regulator PadR
Resolution2.65 Å
Binding residue
(original residue number in PDB)
S39 Q40 Q61 T63 L65
Binding residue
(residue number reindexed from 1)
S38 Q39 Q60 T62 L64
Binding affinityPDBbind-CN: Kd=8.3uM
Enzymatic activity
Enzyme Commision number ?
External links