Structure of PDB 5wnb Chain H Binding Site BS01

Receptor Information
>5wnb Chain H (length=226) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEQLVESGGGLVQPGRSLRLSCVGSGLFEEHAMHWVRQAPGRGLEWVSGI
SWNSGSVGYADSVKGRFTTSRDNAKDILFLEMNTLRSEDTALYFCAIMVA
TTKNDFHYYKDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG
TQTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
>5wnb Chain B (length=11) Species: 11259 (Human respiratory syncytial virus A2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DFHFEVFNFVP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wnb Structures of respiratory syncytial virus G antigen bound to broadly neutralizing antibodies.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		E31 I51 S52 W53 S57 V100 A101 F107 Y109
Binding residue
(residue number reindexed from 1)		E30 I50 S51 W52 S56 V99 A100 F106 Y108
External links