Structure of PDB 5vof Chain H Binding Site BS01

Receptor Information
>5vof Chain H (length=231) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRF
KVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITF
RMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHERQSTRLKMLEVPYVD
RNSCKLSSSFIITQNMFCAGYDTKQEDACQGDAGGPHVTRFKDTYFVTGI
VSWGEGCARKGKYGIYTKVTAFLKWIDRSMK
Ligand information
>5vof Chain A (length=36) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagagccccagcgagauaauacuuggccccgcucuu
<<<<<<....<<<<<......>>>.>>...>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vof Combination of aptamer and drug for reversible anticoagulation in cardiopulmonary bypass.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		L59 Y60 V88 I89 K90 N92 R93 K236 W237 R240
Binding residue
(residue number reindexed from 1)		L44 Y45 V74 I75 K76 N78 R79 K224 W225 R228
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 A195
Catalytic site (residue number reindexed from 1) H42 D88 Q180 G181 D182 A183
Enzyme Commision number 3.4.21.6: coagulation factor Xa.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5vof, PDBe:5vof, PDBj:5vof
PDBsum5vof
PubMed29863725
UniProtP00742|FA10_HUMAN Coagulation factor X (Gene Name=F10)

[Back to BioLiP]