Structure of PDB 5vfx Chain H Binding Site BS01

Receptor Information
>5vfx Chain H (length=99) Species: 1502 (Clostridium perfringens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLNLYAKELVDVVNYLMKKNQLVFSRNNKFIYVNTETIKSMLEKRNYDTV
DGKLYLWRELEWIECAEDRFNKRIKIDGENMYAVVIKYSSYSILKRLYL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vfx Crystal structure of TcpK in complex with oriT DNA of the antibiotic resistance plasmid pCW3.
Resolution2.81 Å
Binding residue
(original residue number in PDB)		S27 R28 Y34 K74 R75 D79 G80 N82
Binding residue
(residue number reindexed from 1)		S25 R26 Y32 K72 R73 D77 G78 N80
Binding affinityPDBbind-CN: Kd=360nM
Enzymatic activity
Enzyme Commision number ?
External links