Structure of PDB 5v6m Chain H Binding Site BS01

Receptor Information
>5v6m Chain H (length=213) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEQLEESGGGLVQPEGSLTLTCKASGFSFSAIAMCWVRQAPGKGLEWIGC
IATDTGSTYYANWAKGRFTISNPSSTTVTLQMTSLTAADTATYFCARNFY
LWGPGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHK
PSNTKVDKKVEPK
Ligand information
>5v6m Chain P (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRKSIHIGPGRAF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v6m Increased epitope complexity correlated with antibody affinity maturation and a novel binding mode revealed by structures of rabbit antibodies against the third variable loop (V3) of HIV-1 gp120.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		C50 A52 D53 N95 Y97
Binding residue
(residue number reindexed from 1)		C50 A52 D54 N98 Y100
External links