Structure of PDB 5ujt Chain H Binding Site BS01

Receptor Information
>5ujt Chain H (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTP
LGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTIS
PNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVML
EMTPQRGDVYTCHVEHPSLQNPIIVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ujt C-terminal modification of the insulin B:11-23 peptide creates superagonists in mouse and human type 1 diabetes.
Resolution1.94 Å
Binding residue
(original residue number in PDB)		F11 G13 L26 Y30 Y37 A57 Y60 W61 E74 V78 H81 N82 L85
Binding residue
(residue number reindexed from 1)		F9 G11 L24 Y28 Y35 A55 Y58 W59 E72 V76 H79 N80 L83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ujt, PDBe:5ujt, PDBj:5ujt
PDBsum5ujt
PubMed29255035
UniProtO19707

[Back to BioLiP]