Structure of PDB 5u3o Chain H Binding Site BS01

Receptor Information
>5u3o Chain H (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGGGLVKPGGSLTLSCSASGFFFDNSWMGWVRQAPGKGLEWVGR
IRRLKDGATGEYGAAVKDRFTISRDDSRNMLYLHMRTLKTEDSGTYYCTM
DEGTPVTRFLEWGYFYYYMAVWGRGTTVIVSSASTKGPSVFPLAPSSKST
SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV
VTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Ligand information
>5u3o Chain A (length=17) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KWNWFDITNWLWYIRKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u3o Potent and broad HIV-neutralizing antibodies in memory B cells and plasma.
Resolution1.761 Å
Binding residue
(original residue number in PDB)		N31 W33 R52A K52C D53 G97 P99 W100F G100G Y100H F100I Y100K
Binding residue
(residue number reindexed from 1)		N31 W33 R53 K55 D56 G103 P105 W112 G113 Y114 F115 Y117
External links