Structure of PDB 5u3m Chain H Binding Site BS01

Receptor Information
>5u3m Chain H (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGGGLVKPGGSLTLSCVTSGFTFSNTWMSWVRQTPGKGLEWVAR
ISRVGDGPIIDYAAPVKGRFIISRDDSRNTLFLHMNNLKTEDTAVYYCTA
DEGAPILRFFEWGYYNYYMDVWGKGTTVIVSSASTKGPSVFPLAPSSKST
SGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV
VTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Ligand information
>5u3m Chain A (length=25) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KELDKWASLWNWFDITNWLWYIRKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u3m Potent and broad HIV-neutralizing antibodies in memory B cells and plasma.
Resolution2.418 Å
Binding residue
(original residue number in PDB)		N31 W33 R52A I56 G97 F100D W100F G100G Y100I
Binding residue
(residue number reindexed from 1)		N31 W33 R53 I59 G103 F110 W112 G113 Y115
External links