Structure of PDB 5u3j Chain H Binding Site BS01

Receptor Information
>5u3j Chain H (length=235) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVKPGGSLRLSCAASGFTFSNTWMSWVRQAPGKGLEWVGR
ISRNKDGAKTEYAAPVRGRFTISRDDSRDTLYLQMTSLKIEDSGRYFCTA
DLGEPVVSRFFEWGSYYYYMDLWGKGTTVTVSSASTKGPSVFPLAPSSKS
TSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS
VVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Ligand information
>5u3j Chain A (length=29) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NEQELLELDKWASLWNWFDITNWLWYIRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5u3j Potent and broad HIV-neutralizing antibodies in memory B cells and plasma.
Resolution2.74 Å
Binding residue
(original residue number in PDB)		T28 N31 W33 R52A K52C D53 G97 P99 F100D F100E W100G G100H Y100J
Binding residue
(residue number reindexed from 1)		T28 N31 W33 R53 K55 D56 G103 P105 F110 F111 W113 G114 Y116
External links