Structure of PDB 5tkk Chain H Binding Site BS01

Receptor Information
>5tkk Chain H (length=213) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQESGPGLVKPSQSLSLTCSVTGYSITRAYYWNWIRQFPGNKLEWMGY
ILYDGRSDYNPSLKNRVSITRDTSKNQFFLKLNSVTAEDTARYYCTREGN
YRAYWGQGTLVTVSAAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTL
TWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPAS
STKVDKKIEPRVP
Ligand information
>5tkk Chain A (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tkk Epitope-based vaccine design yields fusion peptide-directed antibodies that neutralize diverse strains of HIV-1.
Resolution1.55 Å
Binding residue
(original residue number in PDB)		Y33 Y34 Y53 E95 G96 N97 Y98 R99
Binding residue
(residue number reindexed from 1)		Y32 Y33 Y53 E98 G99 N100 Y101 R102
External links