Structure of PDB 5tje Chain H Binding Site BS01

Receptor Information
>5tje Chain H (length=232) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVTQSPRSKVAVTGGKVTLSCHQTNNHDYMYWYRQDTGHGLRLIHYSYVA
DSTEKGDIPDGYKASRPSQENFSLILELASLSQTAVYFCASSDAGGRNTL
YFGAGTRLSVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPD
HVELSWWVNGKEVHSGVCTDPQAYKESNYSYSLSSRLRVSATFWHNPRNH
FRCQVQFHGLSEEDKSPKPVTQNISAEAWGRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5tje Thernary complexes of TCR P14 give insights into the mechanisms behind reestablishment of CTL responses against a viral escape mutant
Resolution3.2 Å
Binding residue
(original residue number in PDB)		D93 G95 G96 R97
Binding residue
(residue number reindexed from 1)		D93 G95 G96 R97
External links