Structure of PDB 5okc Chain H Binding Site BS01

Receptor Information
>5okc Chain H (length=128) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSVDIDASQWQKLTQSRTVITPLGMMMLEIQGELELPKDFASLARRDSPN
EGRFSEQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPMGIMH
FNSKDNKVELVDVMKYKVIFKDRPLPIM
Ligand information
>5okc Chain I (length=27) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TVKIWVKYNEGFSNAVRKNVTWNNLWE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5okc Structural Basis for the Recruitment of Ctf18-RFC to the Replisome.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		P2 S3 V4 Q36 G37 E38 E40 F70 V84 G85 Q88 F106 N107 S108 N111 K126 D127 R128 P129
Binding residue
(residue number reindexed from 1)		P1 S2 V3 Q31 G32 E33 E35 F65 V79 G80 Q83 F101 N102 S103 N106 K121 D122 R123 P124
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0007064 mitotic sister chromatid cohesion
GO:0034398 telomere tethering at nuclear periphery
GO:0035753 maintenance of DNA trinucleotide repeats
Cellular Component
GO:0005634 nucleus
GO:0031390 Ctf18 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5okc, PDBe:5okc, PDBj:5okc
PDBsum5okc
PubMed29225079
UniProtP38877|CTF8_YEAST Chromosome transmission fidelity protein 8 (Gene Name=CTF8)

[Back to BioLiP]