Structure of PDB 5ock Chain H Binding Site BS01

Receptor Information
>5ock Chain H (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLEESGPGLVRPSETLSLSCTVSGFPMSESYFWGWIRQSPGKGLEWLG
SVIHTGTTYYRPSLESRLTIAMDPSKNQVSLSLTSVTVADSAMYYCVRIR
GGSSNWLDPWGPGIVVTASSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVK
GYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTV
TCSVAHPASSTTVDKKIEPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ock Structural Basis of Cross-Reactivity of Anti-Citrullinated Protein Antibodies.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		S32 F34 W48 S51 I53 Y59 I99 R100 G102 S103 S104 N105
Binding residue
(residue number reindexed from 1)		S32 F34 W48 S51 I53 Y59 I99 R100 G102 S103 S104 N105
External links