Structure of PDB 5ifj Chain H Binding Site BS01

Receptor Information
>5ifj Chain H (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLVLTQSPSASASLGASVRLTCTLSSGHSSYVIAWHQQQSEKGPRYLMKV
NSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGAGIL
VFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVT
VAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQV
THEGSTVEKTVAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ifj Stereotyped antibody responses target posttranslationally modified gluten in celiac disease.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		G28 H29 Y37 V38 W107 G108 A109 G114 L116
Binding residue
(residue number reindexed from 1)		G27 H28 Y31 V32 W95 G96 A97 G98 L100
External links