Structure of PDB 5i44 Chain H Binding Site BS01

Receptor Information
>5i44 Chain H (length=64) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNTNMVASELGVSAKTVQRWVKQLNLPAERNELGHYSFTAEDVKVLKSVK
KQISEGTAIQDIHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5i44 Molecular insights into DNA binding and anchoring by the Bacillus subtilis sporulation kinetochore-like RacA protein.
Resolution2.621 Å
Binding residue
(original residue number in PDB)		N2 T3 K15 Q18 K22 G34 H35 Y36
Binding residue
(residue number reindexed from 1)		N2 T3 K15 Q18 K22 G34 H35 Y36
Binding affinityPDBbind-CN: Kd=9.2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5i44, PDBe:5i44, PDBj:5i44
PDBsum5i44
PubMed27085804
UniProtP45870|RACA_BACSU Chromosome-anchoring protein RacA (Gene Name=racA)

[Back to BioLiP]