Structure of PDB 5hrq Chain H Binding Site BS01

Receptor Information
>5hrq Chain H (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>5hrq Chain F (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VNQHLCGSHLVEALYLVCGERGFFYTPKT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5hrq 4S-Hydroxylation of Insulin at ProB28 Accelerates Hexamer Dissociation and Delays Fibrillation.
Resolution1.28 Å
Binding residue
(original residue number in PDB)
H5 G8 S9 E13 Y16 E21 G23 F24 F25 Y26 X28 K29
Binding residue
(residue number reindexed from 1)
H5 G8 S9 E13 Y16 E21 G23 F24 F25 Y26 X28 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:5hrq, PDBe:5hrq, PDBj:5hrq
PDBsum5hrq
PubMed28598606
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]