Structure of PDB 5gm6 Chain H Binding Site BS01

Receptor Information
>5gm6 Chain H (length=151) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPSLSQLKSQVPYPQIIEWYDCDARYPGLLASIKCTKNVIPVPSHWQSKK
EYLSGRSLLGKRPFELPDIIKKTNIEQMRSTLPEKSLKEASRARVQPKMG
ALDLDYKKLHDVFFKIGANWKPDHLLCFGDVYYENRNLFEETNWKRMVDH
K
Ligand information
>5gm6 Chain E (length=103) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaaguaacccuucguggacauuuggucaauuugaaacaauacag
agaugaucagcaguuccccugcauaaggaugaaccguuuuacaaagagau
uua
<<<<<<<<<<.....>>>>>>>>>>.........................
............<<<..<<<.....>>>...>>>................
...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
Resolution3.5 Å
Binding residue
(original residue number in PDB)		K226 E227 R230 K236
Binding residue
(residue number reindexed from 1)		K88 E89 R92 K98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
PDBsum5gm6
PubMed27445306
UniProtQ02554|CUS1_YEAST Cold sensitive U2 snRNA suppressor 1 (Gene Name=CUS1)

[Back to BioLiP]