Structure of PDB 5fl7 Chain H Binding Site BS01

Receptor Information
>5fl7 Chain H (length=113) Species: 4952 (Yarrowia lipolytica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTQSIYNQKEVTQVNIPSTAGELGILANHVPTIQQLKPGVVEVIETNGET
KSYFISGGFATVQPDSELSVNSIEAFQAEDKSLTAEAQKNAQSADEAVAA
EAEIELEVLEALA
Ligand information
>5fl7 Chain I (length=16) Species: 4952 (Yarrowia lipolytica) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fl7 Structure of a Complete ATP Synthase Dimer Reveals the Molecular Basis of Inner Mitochondrial Membrane Morphology.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		I87 E125
Binding residue
(residue number reindexed from 1)		I73 E105
Enzymatic activity
Enzyme Commision number 3.6.1.34: Transferred entry: 7.1.2.2.
Gene Ontology
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0015986 proton motive force-driven ATP synthesis
Cellular Component
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fl7, PDBe:5fl7, PDBj:5fl7
PDBsum5fl7
PubMed27373333
UniProtQ6C877|ATPD_YARLI ATP synthase subunit delta, mitochondrial (Gene Name=ATP16)

[Back to BioLiP]