Structure of PDB 5far Chain H Binding Site BS01

Receptor Information
>5far Chain H (length=120) Species: 1053183 (Bacillus cereus BAG3X2-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKRAGESDDLEHS
VNYGELFELCRKVVEDRTYKLVESIAENIATDILKQYESISRCTIKVIKP
DPPIPGHYRAVAVEITRERP
Ligand information
Ligand ID9MG
InChIInChI=1S/C6H7N5O/c1-11-2-8-3-4(11)9-6(7)10-5(3)12/h2H,1H3,(H3,7,9,10,12)
InChIKeyUUWJNBOCAPUTBK-UHFFFAOYSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.5.0Cn1cnc2c1nc(nc2O)N
CACTVS 3.341Cn1cnc2c(O)nc(N)nc12
ACDLabs 10.04n2c1c(ncn1C)c(nc2N)O
FormulaC6 H7 N5 O
Name9-METHYLGUANINE
ChEMBLCHEMBL1230674
DrugBankDB02489
ZINCZINC000000039178
PDB chain5far Chain E Residue 201 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5far Crystal structure of dihydroneopterin aldolase from Bacillus anthracis complex with 9-METHYLGUANINE
Resolution2.0 Å
Binding residue
(original residue number in PDB)		V17 L71 V72 E73
Binding residue
(residue number reindexed from 1)		V17 L71 V72 E73
Annotation score1
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Feb 20 05:03:47 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5far', asym_id = 'H', bs = 'BS01', title = 'Crystal structure of dihydroneopterin aldolase f...Bacillus anthracis complex with 9-METHYLGUANINE'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5far', asym_id='H', bs='BS01', title='Crystal structure of dihydroneopterin aldolase f...Bacillus anthracis complex with 9-METHYLGUANINE')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004150,0006760', uniprot = '', pdbid = '5far', asym_id = 'H'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004150,0006760', uniprot='', pdbid='5far', asym_id='H')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>