Structure of PDB 5eor Chain H Binding Site BS01

Receptor Information

>5eor Chain H (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QVQLKQSGPGLVQPSQSLSITCTVSGLSLTSYGVHWVRQSPGKGLEWLGV
IWSGGNTDYNAAFISRLSISKDNSKNQVFFKMNSLRADDTAIYYCAIYYR
YGAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTGSSVTLGCLVKGYFPKP
VTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAH
PASSTKVDKKIEPR

Ligand information

>5eor Chain A (length=9) Species: 10254 (Vaccinia virus WR) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VQTGRRPYE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5eor Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
Resolution	2.27 Å
Binding residue (original residue number in PDB)	G34 W53 S54 Y99 R101
Binding residue (residue number reindexed from 1)	G33 W52 S53 Y98 R100

External links

PDB	RCSB:5eor, PDBe:5eor, PDBj:5eor
PDBsum	5eor
PubMed	26889021

[Back to BioLiP]