Structure of PDB 5eoq Chain H Binding Site BS01

Receptor Information
>5eoq Chain H (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWL
AHIWWDDDKYYNPSLQSQLTISKDTSRNQVFLKITSVDTADSATYYCAHD
RGYYAMDYWGQGISVTVSSAKTTAPSVYPLAPVCGTGSSVTLGCLVKGYF
PEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCN
VAHPASSTKVDKKIEPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5eoq Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		W57 D59 D61 R104 G105 Y106
Binding residue
(residue number reindexed from 1)		W54 D56 D58 R101 G102 Y103
External links