Structure of PDB 5e2w Chain H Binding Site BS01

Receptor Information
>5e2w Chain H (length=208) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVQLQESGPGLVKPSQSLSLTCSVTDYSITSGYYWNWIRQFPGNKLEWMG
YISYDGSNNYNPSLKNRISITRDPSKDQFFLNLNSVTTEDTATYYCTRGS
LVWGQGTLVTVSAASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTK
VDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e2w Epitope mapping and structural basis for the recognition of phosphorylated tau by the anti-tau antibody AT8.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		Y27 S31 Y33 Y34 Y54 G99 S100
Binding residue
(residue number reindexed from 1)		Y27 S31 Y33 Y34 Y54 G99 S100
External links