Structure of PDB 5e08 Chain H Binding Site BS01

Receptor Information
>5e08 Chain H (length=229) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGFSISSSYIHWVRQAPGKGLEWVAY
IYPYYGSTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARYY
SSGGSYYRYSRGFDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSCDKTH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e08 Specific Recognition of a Single-Stranded RNA Sequence by a Synthetic Antibody Fragment.
Resolution2.38 Å
Binding residue
(original residue number in PDB)		Y53 Y55 Y56 R99 Y100 Y101 S102 S103 G104 Y107 Y108 R109 S111 G113 D115
Binding residue
(residue number reindexed from 1)		Y52 Y54 Y55 R98 Y99 Y100 S101 S102 G103 Y106 Y107 R108 S110 G112 D114
Binding affinityPDBbind-CN: Kd=10nM
External links