Structure of PDB 5drz Chain H Binding Site BS01

Receptor Information
>5drz Chain H (length=227) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGGGVVKPGASSRLSCAASGFTFTDYYMSWIRQAPGKGLEWVAY
ITKDGSEKKYADSLQHRFAVSRDNANNLVFLQLNTVEDDDTGVYYCARDD
GYYDRSGYYGVFDLWGQGIRVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS
LGTQTYICNVNHKPSNTKVDKRVEPKS
Ligand information
>5drz Chain P (length=15) Species: 11685 (HIV-1 M:B_ARV2/SF2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IWGCSGKLICTTAVP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5drz Molecular basis for epitope recognition by non-neutralizing anti-gp41 antibody F240.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		D31 Y32 Y33 K52A D95 D96 G97 Y98 Y99 D100 R100A Y100D
Binding residue
(residue number reindexed from 1)		D31 Y32 Y33 K53 D99 D100 G101 Y102 Y103 D104 R105 Y108
External links