Structure of PDB 5dlm Chain H Binding Site BS01

Receptor Information
>5dlm Chain H (length=216) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQQSGGGSVKPGGSLKLSCSASGFSLSTYAMSWVRQTPEKRLEWVAS
MSSGGSLYYPDTVKGRFTISRDTVKNIVYLQMSSLRSEDTAMYYCVRGGY
GTSYWGQGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPE
PVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVA
HPASSTKVDKKIVPRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dlm Crystal Structure of the Conserved Amino Terminus of the Extracellular Domain of Matrix Protein 2 of Influenza A Virus Gripped by an Antibody.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		A33 S35 S52 S53 G54 Y58 G98 G99 Y100 G101 T102 S103
Binding residue
(residue number reindexed from 1)		A33 S35 S52 S53 G54 Y58 G98 G99 Y100 G101 T102 S103
External links