Structure of PDB 5dd0 Chain H Binding Site BS01

Receptor Information
>5dd0 Chain H (length=221) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLQESGPGLVKPSETLSVTCAVSGVSFSSFWWGWIRQSPGKGLEWIGT
IYGSSGRGEYNPSLKSRTTISRDTSKSQISLELTSVTAADTAIYYCSRGL
FQPNGFSFTLTSYWFDVWGPGVPVTVSSASTKGPSVFPLAPSTAALGCLV
KDYFPEPVTVSWNSGSLTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYVCNVNHKPSNTKVDKRVEI
Ligand information
>5dd0 Chain P (length=11) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLELDKWASLW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dd0 Initiation of immune tolerance-controlled HIV gp41 neutralizing B cell lineages.
Resolution2.488 Å
Binding residue
(original residue number in PDB)		W33 Y52 S55 R57 G58 E59 F101 F108 L110
Binding residue
(residue number reindexed from 1)		W33 Y52 S55 R57 G58 E59 F101 F108 L110
External links