Structure of PDB 4z89 Chain H Binding Site BS01

Receptor Information
>4z89 Chain H (length=64) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGELR
GRRGYVPHNMVSEV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z89 A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
Resolution2.64 Å
Binding residue
(original residue number in PDB)		F1324 Y1326 P1333 N1334 E1341 D1359 F1361 P1374 N1376 M1377
Binding residue
(residue number reindexed from 1)		F7 Y9 P16 N17 E24 D42 F44 P57 N59 M60
Enzymatic activity
Enzyme Commision number ?
External links