Structure of PDB 4z88 Chain H Binding Site BS01

Receptor Information
>4z88 Chain H (length=70) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPEFRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFY
WGELRGRRGYVPHNMVSEVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z88 A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		Y1326 P1333 N1334 E1341 D1359 F1361 Y1372
Binding residue
(residue number reindexed from 1)		Y14 P21 N22 E29 D47 F49 Y60
Enzymatic activity
Enzyme Commision number ?
External links