Structure of PDB 4xmk Chain H Binding Site BS01

Receptor Information
>4xmk Chain H (length=217) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVGSGGGLIQPGGSLRLSCAASDFSVSEYYMTWVRQAPGKGLEWVAV
LYKDGSQFYAPSVKGRFIVSRDNSKNSLYLQMNNLRGEDTAVYFCARENA
DYGSDYYFGMDVWGQGTAVAVSSASTKGPSVFPLAPSGTAALGCLVKDYF
PEPVTVSWNSGALTSSVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKAEP
Ligand information
>4xmk Chain P (length=11) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IHIGPGRAFYT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xmk Functional and Structural Characterization of Human V3-Specific Monoclonal Antibody 2424 with Neutralizing Activity against HIV-1 JRFL.
Resolution3.179 Å
Binding residue
(original residue number in PDB)		Y33 Y52 D54 S56 F58 Y99 G100 D100B
Binding residue
(residue number reindexed from 1)		Y33 Y52 D54 S56 F58 Y102 G103 D105
External links