Structure of PDB 4xh2 Chain H Binding Site BS01

Receptor Information
>4xh2 Chain H (length=213) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISEVQLVESGGGLVQPGGSLRLSCAASGFNVSSYSIHWVRQAPGKGLEWV
AYISSSSGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAR
TWYYGFDYWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4xh2 Engineering Synthetic Antibody Inhibitors Specific for LD2 or LD4 Motifs of Paxillin.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S31 Y32 S33 H35 Y50 Y56 Y58 T95 W96 Y97 Y98
Binding residue
(residue number reindexed from 1)		S33 Y34 S35 H37 Y52 Y59 Y61 T101 W102 Y103 Y104
External links