Structure of PDB 4wy7 Chain H Binding Site BS01

Receptor Information
>4wy7 Chain H (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVQSGAEVKRPGSSVTVSCKASGGSFSTYALSWVRQAPGRGLEWMGGV
IPLLTITNYAPRFQGRITITADRSTSTAYLELNSLRPEDTAVYYCAREGT
TGWGWLGKPIGAFAHWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEP
Ligand information
>4wy7 Chain P (length=15) Species: 11705 (Human immunodeficiency virus type 1 (WMJ2 ISOLATE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NWFDITNWLWYIKKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wy7 The Atomic Structure of the HIV-1 gp41 Transmembrane Domain and Its Connection to the Immunogenic Membrane-proximal External Region.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		T31 A33 G50 V51 I52 I56 N58 E95 G100D K100E P100F
Binding residue
(residue number reindexed from 1)		T30 A32 G49 V50 I51 I56 N58 E98 G107 K108 P109
External links