Structure of PDB 4u6g Chain H Binding Site BS01

Receptor Information
>4u6g Chain H (length=232) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVKPGGSLRLSCSASGFDFDNAWMTWVRQPPGKGLEWVGR
ITGPGEGWSVDYAAPVEGRFTISRLNSINFLYLEMNNLRMEDSGLYFCAR
TGKYYDFWSGYPPGEEYFQDWGRGTLVTVSSASTKGPSVFPLAPSSKSTS
GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
TVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Ligand information
>4u6g Chain P (length=17) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SLWNWFNITNGLWKIKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4u6g Structural Fidelity and Neutralizing Antibody Binding Capacity of Hydrocarbon-Stapled HIV-1 Antigens
Resolution4.2012 Å
Binding residue
(original residue number in PDB)		W33 G52C E53 K97 F100A W100B P100F P100G
Binding residue
(residue number reindexed from 1)		W33 G55 E56 K103 F107 W108 P112 P113
External links