Structure of PDB 4tqe Chain H Binding Site BS01

Receptor Information
>4tqe Chain H (length=220) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQQSGAEIVRSGASVKLSCAASGFNIKDYYMHWVKQRPEQGLEWIGW
IDPENGDIAYAPKFQGKATMTADTSSNTAYLQLSRLTSEDTAVYFCNGRG
GMITTDFFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLV
KGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSET
VTCNVAHPASSTKVDKKIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4tqe Structure of tau peptide in complex with Tau5 antibody Fab fragment
Resolution1.6 Å
Binding residue
(original residue number in PDB)		K30 D31 Y33 H35 W50 D52 E54 D57 A59 R99 G100 G101 M102 I103 F107
Binding residue
(residue number reindexed from 1)		K30 D31 Y33 H35 W50 D52 E54 D57 A59 R99 G100 G101 M102 I103 F107
External links