Structure of PDB 4rku Chain H Binding Site BS01

Receptor Information
>4rku Chain H (length=82) Species: 3888 (Pisum sativum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YFDLEDIGNTTGQWDLYGSDAPSPYSPLQSKFFETFAAPFTKRGLLLKFL
ILGGGSTLAYFSTTASGDILPIVKGPQLPPKL
Ligand information
>4rku Chain I (length=26) Species: 3888 (Pisum sativum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSLFVPLVGLLFPAVAMASLFLHVEK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4rku Crystal structure of plant Photosystem I at 3.1 Angstrom resolution
Resolution3.0 Å
Binding residue
(original residue number in PDB)		L114 F117
Binding residue
(residue number reindexed from 1)		L58 F61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4rku, PDBe:4rku, PDBj:4rku
PDBsum4rku
PubMed
UniProtE1C9K9

[Back to BioLiP]