Structure of PDB 4pso Chain H Binding Site BS01

Receptor Information
>4pso Chain H (length=220) Species: 272557 (Aeropyrum pernix K1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMLPTLRTGLVIAAGYADKVRRVLFAQLRDAIKSGELSNKDVAMAAGNLN
RVLFELLVNKLKADKLDVVRIQIDYEVRDSQIQFDFSTLRVELWRRVPEE
EIAPIVEDFARAAPRLLEEEIRFTVEKVGETDVGDVVYRIMYRGSDVGAL
IVTPLNGEALVRGAVVEPTPLLLKRTRVQVEADRIDDFVRESVSRLFSEA
QNVEKREAVRVVNEILSLVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pso Entrapment of DNA in an intersubunit tunnel system of a single-stranded DNA-binding protein.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
R5 K17 V21 A24 Q25
Binding residue
(residue number reindexed from 1)
R7 K19 V23 A26 Q27
Enzymatic activity
Enzyme Commision number ?
External links