Structure of PDB 4onf Chain H Binding Site BS01

Receptor Information
>4onf Chain H (length=212) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVKLVESGGGLVKPGASLKLSCAASGFTFSNYGMSWVRQNSDKRLEWVAS
IRSGGGRTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCVRYD
HYSGSSDYWGQGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVT
VTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPA
SSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4onf Crystal structure reveals conservation of amyloid-beta conformation recognized by 3D6 following humanization to bapineuzumab.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		G33 S50 R52 Y59 Y99 S105 S106
Binding residue
(residue number reindexed from 1)		G33 S50 R52 Y59 Y99 S105 S106
External links