Structure of PDB 4o4y Chain H Binding Site BS01

Receptor Information
>4o4y Chain H (length=215) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSVEESGGRLVTPGTPLTLTCTVSGFSLSSYPMNWVRQAPGKGLEWIGGI
GTSGNIWYASWAKGRFIISRASSTTVDLKVTSPTTEDTATYFCARGLYND
YTVWGPGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4o4y Structure and specificity of an antibody targeting a proteolytically cleaved IgG hinge.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
P32 G49 S53 N55 W57 G96 L97 Y98 N99 Y101
Binding residue
(residue number reindexed from 1)
P32 G49 S53 N55 W57 G96 L97 Y98 N99 Y101
External links