Structure of PDB 4nrx Chain H Binding Site BS01

Receptor Information
>4nrx Chain H (length=231) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGESLKISCKVSGYNFASEWIGWVRQMPGKGLEWMGI
IYPGDSDTKYSPSFQGQVIISADKSINTAYLQWSSLKASDTAIYYCARQN
HYGSGSYFYRTAYYYAMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSG
GTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT
VPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Ligand information
>4nrx Chain P (length=14) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NEQELLELDKWASL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nrx Structural Basis for HIV-1 Neutralization by 2F5-Like Antibodies m66 and m66.6.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		S31 W33 Y52 D54 D56 K58 H97 Y100C R100F T100G A100H Y100I Y100K
Binding residue
(residue number reindexed from 1)		S31 W33 Y52 D55 D57 K59 H101 Y107 R110 T111 A112 Y113 Y115
External links