Structure of PDB 4ngh Chain H Binding Site BS01

Receptor Information
>4ngh Chain H (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKRPGSSVTVSCKASGGSFSTYALSWVRQAPGRGLEWMGG
VIPLLTITNYAPRFQGRITITADRSTSTAYLELNSLRPEDTAVYYCAREG
TTGWGWLGKPIGAFAHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SSLGTQTYICNVNHKPSNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ngh Stapled HIV-1 peptides recapitulate antigenic structures and engage broadly neutralizing antibodies.
Resolution2.68 Å
Binding residue
(original residue number in PDB)		S28 F29 S30 T31 G50 V51 I52 N58 E95 G100D K100E P100F
Binding residue
(residue number reindexed from 1)		S28 F29 S30 T31 G50 V51 I52 N59 E99 G108 K109 P110
External links