Structure of PDB 4n0y Chain H Binding Site BS01

Receptor Information
>4n0y Chain H (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGW
INPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDR
GFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ
TYICNVNHKPSNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4n0y Structure of Hepatitis C Virus Envelope Glycoprotein E1 Antigenic Site 314-324 in Complex with Antibody IGH526.
Resolution1.749 Å
Binding residue
(original residue number in PDB)
A33 W50 N52 N56 G97 F98 Y100E
Binding residue
(residue number reindexed from 1)
A33 W50 N52 N57 G101 F102 Y109
External links