Structure of PDB 4kvm Chain H Binding Site BS01

Receptor Information
>4kvm Chain H (length=153) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDIRPARISDLTGMQNCNLHNLPENYQLKYYLYHAISWPMLSYVATDPKG
RVVGYVLAKMEEEPKDGIPHGHITSVSVMRSYRHLGLAKRLMVQSQRAMV
EVYGAKYMSLHVRKSNRAAIHLYRDTLQFDVQGIESKYYADGEDAYAMHK
DFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4kvm Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
Resolution2.597 Å
Binding residue
(original residue number in PDB)		E24 Y26 T74 H111 Y138 Y139
Binding residue
(residue number reindexed from 1)		E24 Y26 T74 H111 Y138 Y139
Enzymatic activity
Enzyme Commision number 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
Gene Ontology
Molecular Function
GO:0004596 peptide alpha-N-acetyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
Biological Process
GO:0006474 N-terminal protein amino acid acetylation
Cellular Component
GO:0031415 NatA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4kvm, PDBe:4kvm, PDBj:4kvm
PDBsum4kvm
PubMed23912279
UniProtQ9UTI3|ARD1_SCHPO N-terminal acetyltransferase A complex catalytic subunit ard1 (Gene Name=ard1)

[Back to BioLiP]