Structure of PDB 4hs8 Chain H Binding Site BS01

Receptor Information
>4hs8 Chain H (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYWINWVRQAPGKGLEWVGD
IYPSDSFTNYNQNFKDRFTISRDKSKNTAYLQMNSLRAEDTAVYYCARSS
IYYGKDYVLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hs8 Glycan shifting on hepatitis C virus (HCV) e2 glycoprotein is a mechanism for escape from broadly neutralizing antibodies.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		W33 Y52 F56 I97 Y98 Y100C
Binding residue
(residue number reindexed from 1)		W33 Y52 F57 I101 Y102 Y107
External links