Structure of PDB 4hpo Chain H Binding Site BS01

Receptor Information
>4hpo Chain H (length=217) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVQSGAEVKKPGESLKISCKGSGYRFTSYWIVWVRQMPGKGLEWMGI
IYPGDFDTKYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARLG
GRYYHDSSGYYYLDYWGQGTLVTVSSTKGPSVFPLAPSTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKRVEP
Ligand information
>4hpo Chain P (length=15) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DKKQKVHALFYKLDI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4hpo Vaccine Induction of Antibodies against a Structurally Heterogeneous Site of Immune Pressure within HIV-1 Envelope Protein Variable Regions 1 and 2.
Resolution1.694 Å
Binding residue
(original residue number in PDB)		R28 T30 S31 W33 Y52 D54 D56 L95 Y99 Y100 H100A D100B S100C G100E Y100G
Binding residue
(residue number reindexed from 1)		R28 T30 S31 W33 Y52 D55 D57 L99 Y103 Y104 H105 D106 S107 G109 Y111
External links