Structure of PDB 4h1l Chain H Binding Site BS01

Receptor Information
>4h1l Chain H (length=111) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIV
NDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSLRDGYTGE
LFFGEGSRLTV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4h1l T-cell receptor (TCR) interaction with peptides that mimic nickel offers insight into nickel contact allergy.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		D28 R94 D95 G96
Binding residue
(residue number reindexed from 1)		D28 R94 D95 G96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007166 cell surface receptor signaling pathway
Cellular Component
GO:0005886 plasma membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4h1l, PDBe:4h1l, PDBj:4h1l
PDBsum4h1l
PubMed23091041
UniProtL7MTL0

[Back to BioLiP]