Structure of PDB 4glr Chain H Binding Site BS01

Receptor Information
>4glr Chain H (length=229) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVTLDESGGGLQTPGGGLSLVCKASGFTLSSYQMMWVRQAPGKGLEWVAG
ITSRGGVTGYGSAVKGRATISRDNGQSTVRLQLNNLRAEDTGTYYCAKPA
LDSDQCGFPEAGCIDAWGHGTEVIVSSASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SSLGTQTYICNVNHKPSNTKVDKKVEPKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4glr An Ultra-specific Avian Antibody to Phosphorylated Tau Protein Reveals a Unique Mechanism for Phosphoepitope Recognition.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Q33 T52 R53 G55 D100 Q100A C100B F100D E100F
Binding residue
(residue number reindexed from 1)		Q33 T52 R54 G56 D104 Q105 C106 F108 E110
External links