Structure of PDB 4gl9 Chain H Binding Site BS01

Receptor Information
>4gl9 Chain H (length=125) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIR
DSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVL
KLVHHYMGAYYIYKIPLVLSRPLSS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gl9 SOCS3 binds specific receptor-JAK complexes to control cytokine signaling by direct kinase inhibition.
Resolution3.9 Å
Binding residue
(original residue number in PDB)
G53 R71 S73 S74 T81 N92 R94 L104 Q105 D107 Q112 Y142 Y143 I144
Binding residue
(residue number reindexed from 1)
G32 R50 S52 S53 T60 N71 R73 L83 Q84 D86 Q91 Y110 Y111 I112
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4gl9, PDBe:4gl9, PDBj:4gl9
PDBsum4gl9
PubMed23454976
UniProtO35718|SOCS3_MOUSE Suppressor of cytokine signaling 3 (Gene Name=Socs3)

[Back to BioLiP]