Structure of PDB 4gaj Chain H Binding Site BS01

Receptor Information

>4gaj Chain H (length=209) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVQLQESGPSLVKPSQTLSLTCSVTGDTSGYWNWIRKFPGNKLEYMGYIS
YSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITTTT
YAMDYWGQGTSVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVT
WNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASS
TKVDKKIVP

Ligand information

>4gaj Chain P (length=10) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LINTNGSWHI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4gaj Toward a Hepatitis C Virus Vaccine: the Structural Basis of Hepatitis C Virus Neutralization by AP33, a Broadly Neutralizing Antibody.
Resolution	2.51 Å
Binding residue (original residue number in PDB)	Y33 Y50 Y58 Y100
Binding residue (residue number reindexed from 1)	Y31 Y48 Y56 Y101

External links

PDB	RCSB:4gaj, PDBe:4gaj, PDBj:4gaj
PDBsum	4gaj
PubMed	22993159

[Back to BioLiP]