Structure of PDB 4gag Chain H Binding Site BS01

Receptor Information
>4gag Chain H (length=212) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLQESGPSLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGNKLEYMGY
ISYSGSTYYNLSLRSRISITRDTSKNQYYLQLNSVTTEDTATYYCALITT
TTYAMDYWGQGTSVTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVT
VTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPA
SSTKVDKKIVPR
Ligand information
>4gag Chain P (length=12) Species: 329389 (Hepatitis C virus (isolate Glasgow)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QLINTNGSWHVN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4gag Toward a Hepatitis C Virus Vaccine: the Structural Basis of Hepatitis C Virus Neutralization by AP33, a Broadly Neutralizing Antibody.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y33 Y50 Y58 T97 Y100
Binding residue
(residue number reindexed from 1)		Y33 Y50 Y58 T100 Y103
External links