Structure of PDB 4g6f Chain H Binding Site BS01

Receptor Information
>4g6f Chain H (length=232) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVKPGGSLRLSCSASGFDFDNAWMTWVRQPPGKGLEWVGR
ITGPGEGWSVDYAAPVEGRFTISRLNSINFLYLEMNNLRMEDSGLYFCAR
TGKYYDFWSGYPPGEEYFQDWGRGTLVTVSSASTKGPSVFPLAPSSKSTS
GGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVV
TVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Ligand information
>4g6f Chain P (length=29) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NEQELLELDKWASLWNWFDITNWLWYIRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4g6f Broad and potent neutralization of HIV-1 by a gp41-specific human antibody.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		N31 W33 G52C E53 K97 Y99 F100A W100B G100D P100F P100G
Binding residue
(residue number reindexed from 1)		N31 W33 G55 E56 K103 Y105 F107 W108 G110 P112 P113
External links