Structure of PDB 4asu Chain H Binding Site BS01

Receptor Information
>4asu Chain H (length=83) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTFASPTQVFFNSANVRQVDVPTQTGAFGILAAHVPTLQVLRPGLVVVHA
EDGTTSKYFVSSGSVTVNADSSVQLLAEEAVTL
Ligand information
>4asu Chain I (length=23) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SYIRYSQICAKAVRDATIKIVKV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4asu Structural Evidence of a New Catalytic Intermediate in the Pathway of ATP Hydrolysis by F1-ATPase from Bovine Heart Mitochondria.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		V57 P60 S78 S79 G80 E95 E96
Binding residue
(residue number reindexed from 1)		V40 P43 S61 S62 G63 E78 E79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0015986 proton motive force-driven ATP synthesis
Cellular Component
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4asu, PDBe:4asu, PDBj:4asu
PDBsum4asu
PubMed22733764
UniProtP05630|ATPD_BOVIN ATP synthase subunit delta, mitochondrial (Gene Name=ATP5F1D)

[Back to BioLiP]